Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystatin-C (Cst3)

Product Specifications

Product Name Alternative

Cystatin-3

Abbreviation

Recombinant Mouse Cst3 protein

Gene Name

Cst3

UniProt

P21460

Expression Region

21-140aa

Organism

Mus musculus (Mouse)

Target Sequence

ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.

Molecular Weight

20.4 kDa

References & Citations

"Transforming growth factor beta regulates cystatin C in serum-free mouse embryo (SFME) cells." Solem M., Rawson C., Lindburg K., Barnes D. Biochem. Biophys. Res. Commun. 172:945-951 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNG1 Polyclonal Antibody
E-AB-53386-01 20 µL

CCNG1 Polyclonal Antibody

Sign In for Pricing
View Details
CCNG1 Polyclonal Antibody
E-AB-53386-02 60 µL

CCNG1 Polyclonal Antibody

Sign In for Pricing
View Details
CCNG1 Polyclonal Antibody
E-AB-53386-03 120 µL

CCNG1 Polyclonal Antibody

Sign In for Pricing
View Details
CCNG1 Polyclonal Antibody
E-AB-53386-04 200 µL

CCNG1 Polyclonal Antibody

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), CF568 conjugate, 0.1mg/mL
BNC680784-500 1x 500 µL

CD56 / NCAM (NCAM1/784), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RFK Rabbit Polyclonal Antibody
TA369615 100 µL

RFK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details