Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Subtilosin-A (sboA)

Product Specifications

Product Name Alternative

Antilisterial bacteriocin subtilosin (sbo)

Abbreviation

Recombinant Bacillus subtilis sboA protein

Gene Name

SboA

UniProt

O07623

Expression Region

9-43aa

Organism

Bacillus subtilis (strain 168)

Target Sequence

NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium, A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium

Molecular Weight

18.8 kDa

References & Citations

"Subtilosin A, a new antibiotic peptide produced by Bacillus subtilis 168: isolation, structural analysis, and biogenesis." Babasaki K., Takao T., Shimonishi Y., Kurahashi K. J. Biochem. 98:585-603 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Immunoglobulin Heavy Constant Epsilon (IGHE) Antibody
abx101284-01 100 µL

Immunoglobulin Heavy Constant Epsilon (IGHE) Antibody

Sign In for Pricing
View Details
Immunoglobulin Heavy Constant Epsilon (IGHE) Antibody
abx101284-02 200 µL

Immunoglobulin Heavy Constant Epsilon (IGHE) Antibody

Sign In for Pricing
View Details
Immunoglobulin Heavy Constant Epsilon (IGHE) Antibody
abx101284-03 1 mL

Immunoglobulin Heavy Constant Epsilon (IGHE) Antibody

Sign In for Pricing
View Details
Rad9, phosphorylated (Ser328) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (MaxLight 550) discontinued
R0444-67D-ML550 100 µL

Rad9, phosphorylated (Ser328) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Bi-Phospho-YES1(Y537)/Phospho-SRC(Y530) Antibody Blocking peptide
MBS9225071-01 0.5 mg

Bi-Phospho-YES1(Y537)/Phospho-SRC(Y530) Antibody Blocking peptide

Sign In for Pricing
View Details
Bi-Phospho-YES1(Y537)/Phospho-SRC(Y530) Antibody Blocking peptide
MBS9225071-02 5x 0.5 mg

Bi-Phospho-YES1(Y537)/Phospho-SRC(Y530) Antibody Blocking peptide

Sign In for Pricing
View Details