Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Programmed cell death 1 ligand 2 (PDCD1LG2), partial

Product Specifications

Product Name Alternative

Butyrophilin B7-DC (B7-DC) (CD_antigen: CD273) (B7DC) (CD273) (PDCD1L2) (PDL2)

Abbreviation

Recombinant Human PDCD1LG2 protein, partial

Gene Name

PDCD1LG2

UniProt

Q9BQ51

Expression Region

21-118aa

Organism

Homo sapiens (Human)

Target Sequence

FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity) .

Molecular Weight

15.1 kDa

References & Citations

"B7-DC, a new dendritic cell molecule with potent costimulatory properties for T cells." Tseng S.-Y., Otsuji M., Gorski K., Huang X., Slansky J.E., Pai S.I., Shalabi A., Shin T., Pardoll D.M., Tsuchiya H. J. Exp. Med. 193:839-846 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quinoid Dihydropteridine Reductase (QDPR) Antibody
abx034130-01 80 µL

Quinoid Dihydropteridine Reductase (QDPR) Antibody

Sign In for Pricing
View Details
Quinoid Dihydropteridine Reductase (QDPR) Antibody
abx034130-02 400 µL

Quinoid Dihydropteridine Reductase (QDPR) Antibody

Sign In for Pricing
View Details
Anti-Calnexin Antibody
CPA1130-01 30 µL

Anti-Calnexin Antibody

Sign In for Pricing
View Details
Anti-Calnexin Antibody
CPA1130-02 50 μL

Anti-Calnexin Antibody

Sign In for Pricing
View Details
Anti-Calnexin Antibody
CPA1130-03 100 µL

Anti-Calnexin Antibody

Sign In for Pricing
View Details
Anti-Calnexin Antibody
CPA1130-04 200 µL

Anti-Calnexin Antibody

Sign In for Pricing
View Details