Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus mRNA interferase MazF (mazF)

Product Specifications

Product Name Alternative

Toxin MazF (mRNA interferase MazF)

Abbreviation

Recombinant Staphylococcus aureus mazF protein

Gene Name

MazF

UniProt

Q7A0D7

Expression Region

1-120aa

Organism

Staphylococcus aureus (strain MW2)

Target Sequence

MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE.

Molecular Weight

17.4 kDa

References & Citations

"Genome and virulence determinants of high virulence community-acquired MRSA." Baba T., Takeuchi F., Kuroda M., Yuzawa H., Aoki K., Oguchi A., Nagai Y., Iwama N., Asano K., Naimi T., Kuroda H., Cui L., Yamamoto K., Hiramatsu K. Lancet 359:1819-1827 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS701167 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
TTC22 (NM_001114108) Human Over-expression Lysate
LC426454 20 µg

TTC22 (NM_001114108) Human Over-expression Lysate

Sign In for Pricing
View Details
TCP10L2 Human Gene Knockout Kit (CRISPR)
KN426628 1 Kit

TCP10L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Live-or-DyeTM 375/600 Fixable Viability Staining Kit (200 assays)
#32014 1 Kit

Live-or-DyeTM 375/600 Fixable Viability Staining Kit (200 assays)

Sign In for Pricing
View Details
SP3 Antibody
KC-3606-01 50 μL

SP3 Antibody

Sign In for Pricing
View Details
SP3 Antibody
KC-3606-02 100 µL

SP3 Antibody

Sign In for Pricing
View Details