Recombinant Staphylococcus aureus mRNA interferase MazF (mazF)
Product Specifications
Product Name Alternative
Toxin MazF (mRNA interferase MazF)
Abbreviation
Recombinant Staphylococcus aureus mazF protein
Gene Name
MazF
UniProt
Q7A0D7
Expression Region
1-120aa
Organism
Staphylococcus aureus (strain MW2)
Target Sequence
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Tag
N-terminal 6xHis-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Others
Relevance
Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Toxic component of a type II toxin-antitoxin (TA) system. Ribosome-independent, sequence-specific endoribonuclease that cleaves mRNA, thus inhibiting protein synthesis and inducing bacterial stasis. It cuts between the first and nucleotides of 5'-UACAU-3' in single-stranded RNA. Neutralized by coexpression with cognate antitoxin MazE.
Molecular Weight
17.4 kDa
References & Citations
"Genome and virulence determinants of high virulence community-acquired MRSA." Baba T., Takeuchi F., Kuroda M., Yuzawa H., Aoki K., Oguchi A., Nagai Y., Iwama N., Asano K., Naimi T., Kuroda H., Cui L., Yamamoto K., Hiramatsu K. Lancet 359:1819-1827 (2002)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1986-500 1x 500 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680280-100 1x 100 µL
Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP720090L 500 µg
Carbonic Anhydrase IV (CA4) (NM_000717) Human Recombinant Protein
Sign In for Pricing
View Details ![TTC7A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]](https://cdn.genprice.uk/products/937/68dd1b87061270361ea20b27/imageurl/ta812298am.webp)
TA812298AM 100 µL
TTC7A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]
Sign In for Pricing
View Details