Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin

Product Specifications

Product Name Alternative

Fibrinogen-clotting enzyme (Snake venom serine protease) (SVSP) (Venombin B)

Abbreviation

Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin protein

UniProt

P82981

Expression Region

1-234aa

Organism

Agkistrodon contortrix contortrix (Southern copperhead)

Target Sequence

VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTAAHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPEVLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVSYGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Thrombin-like snake venom serine protease that cleaves beta chain of fibrinogen (FGB), releasing fibrinopeptide B. Has a coagulant activity activating blood coagulation factors V (F5) and XIII (F13A1) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Thrombin-like snake venom serine protease that cleaves beta chain of fibrinogen (FGB), releasing fibrinopeptide B. Has a coagulant activity activating blood coagulation factors V (F5) and XIII (F13A1) .

Molecular Weight

32.4 kDa

References & Citations

"A novel venombin B from Agkistrodon contortrix contortrix: evidence for recognition properties in the surface around the primary specificity pocket different from thrombin." Amiconi G., Amoresano A., Boumis G., Brancaccio A., De Cristofaro R., De Pascalis A., Di Girolamo S., Maras B., Scaloni A. Biochemistry 39:10294-10308 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PDE10A shRNA Plasmid
abx973589-01 150 µg

Mouse PDE10A shRNA Plasmid

Sign In for Pricing
View Details
Mouse PDE10A shRNA Plasmid
abx973589-02 300 µg

Mouse PDE10A shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Abhd17a shRNA (UAS) - Lentiviral mouse Abhd17a shRNA (UAS, RFP) (25)
GTR15280187 1 Vial

Lentiviral mouse Abhd17a shRNA (UAS) - Lentiviral mouse Abhd17a shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
MAP6D1 (NM_024871) Human Tagged ORF Clone
RC202993 10 µg

MAP6D1 (NM_024871) Human Tagged ORF Clone

Sign In for Pricing
View Details
Genistein
40700024-2 25 mg

Genistein

Sign In for Pricing
View Details
Rad18 Rabbit pAb
E45R25782N-100 100 µL

Rad18 Rabbit pAb

Sign In for Pricing
View Details