Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)

Product Specifications

Product Name Alternative

Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

Abbreviation

Recombinant Bovine FDX1 protein

Gene Name

FDX1

UniProt

P00257

Expression Region

59-186aa

Organism

Bos taurus (Bovine)

Target Sequence

SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (By similarity) .

Molecular Weight

19.5 kDa

References & Citations

"Molecular cloning and amino acid sequence of the precursor form of bovine adrenodoxin: evidence for a previously unidentified COOH-terminal peptide." Okamura T., John M.E., Zuber M.X., Simpson E.R., Waterman M.R. Proc. Natl. Acad. Sci. U.S.A. 82:5705-5709 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF488A conjugate, 0.1mg/mL
BNC882955-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details