Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ig kappa chain V-V region K2

Product Specifications

Product Name Alternative

Ig kappa chain V-V region K2; Fragment

Abbreviation

Recombinant Mouse Ig kappa chain V-V region K2 protein

UniProt

P01635

Expression Region

21-115aa

Organism

Mus musculus (Mouse)

Target Sequence

DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

The gene was isolated and sequenced separately from two different sources, embryos and cultured plasmacytoma cells that secrete the similar kappa chain MOPC 149.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

References & Citations

"Multiple related immunoglobulin variable-region genes identified by cloning and sequence analysis." Seidman J.G., Leder A., Edgell M.H., Polsky F., Tilghman S.M., Tiemeier D.C., Leder P. Proc. Natl. Acad. Sci. U.S.A. 75:3881-3885 (1978)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-500 1x 500 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-100 1x 100 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details