Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prohibitin (Phb), partial

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 32 (BAP 32)

Abbreviation

Recombinant Mouse Phb protein, partial

Gene Name

Phb

UniProt

P67778

Expression Region

174-272aa

Organism

Mus musculus (Mouse)

Target Sequence

TFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transcription

Relevance

Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity) .

Molecular Weight

16.2 kDa

References & Citations

"The IgM antigen receptor of B lymphocytes is associated with prohibitin and a prohibitin-related protein." Terashima M., Kim K.-M., Adachi T., Nielsen P.J., Reth M., Koehler G., Lamers M.C. EMBO J. 13:3782-3792 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

16-Acetoxy-6-oxo-7,13-labdadien-15-oic acid
T130200-01 1 mg

16-Acetoxy-6-oxo-7,13-labdadien-15-oic acid

Sign In for Pricing
View Details
16-Acetoxy-6-oxo-7,13-labdadien-15-oic acid
T130200-02 5 mg

16-Acetoxy-6-oxo-7,13-labdadien-15-oic acid

Sign In for Pricing
View Details
Mouse Monoclonal Bone marrow stromal cell antigen 1/CD157 Antibody (SY11B5) [CoraFluor 1]
NBP2-37711CL1 0.1 mL

Mouse Monoclonal Bone marrow stromal cell antigen 1/CD157 Antibody (SY11B5) [CoraFluor 1]

Sign In for Pricing
View Details
Human OPRM1 Recombinant Protein (N-His-KSI)
HA561012-01 50 µg

Human OPRM1 Recombinant Protein (N-His-KSI)

Sign In for Pricing
View Details
Human OPRM1 Recombinant Protein (N-His-KSI)
HA561012-02 100 µg

Human OPRM1 Recombinant Protein (N-His-KSI)

Sign In for Pricing
View Details
Human OPRM1 Recombinant Protein (N-His-KSI)
HA561012-03 1 mg

Human OPRM1 Recombinant Protein (N-His-KSI)

Sign In for Pricing
View Details