Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleoside diphosphate kinase B (NME2), partial

Product Specifications

Product Name Alternative

C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC:2.7.13.3) ) (nm23-H2) (NM23B)

Abbreviation

Recombinant Human NME2 protein, partial

Gene Name

NME2

UniProt

P22392

Expression Region

2-152aa

Organism

Homo sapiens (Human)

Target Sequence

ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Exhibits histidine protein kinase activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically

Molecular Weight

24.2 kDa

References & Citations

"Human c-myc transcription factor PuF identified as nm23-H2 nucleoside diphosphate kinase, a candidate suppressor of tumor metastasis." Postel E.H., Berberich S.J., Flint S.J., Ferrone C.A. Science 261:478-480 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kbtbd8 3'UTR Luciferase Stable Cell Line
TU206531 1.0 mL

Kbtbd8 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Olr312-set siRNA/shRNA/RNAi Lentivector (Rat)
34305096 4x 500 ng

Olr312-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Crbn Rat shRNA Plasmid (Locus ID 297498)
TL702403 1 Kit

Crbn Rat shRNA Plasmid (Locus ID 297498)

Sign In for Pricing
View Details
Transfer pipet, 8.5mL, 137mm
138090-250 250/Box

Transfer pipet, 8.5mL, 137mm

Sign In for Pricing
View Details
Phospho-Estrogen Receptor alpha (Ser167) polyclonal antibody
orb1725655-01 50 µL

Phospho-Estrogen Receptor alpha (Ser167) polyclonal antibody

Sign In for Pricing
View Details
Phospho-Estrogen Receptor alpha (Ser167) polyclonal antibody
orb1725655-02 100 µL

Phospho-Estrogen Receptor alpha (Ser167) polyclonal antibody

Sign In for Pricing
View Details