Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial

Product Specifications

Product Name Alternative

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) (HNRPG) (RBMXP1)

Abbreviation

Recombinant Human RBMX protein, partial

Gene Name

RBMX

UniProt

P38159

Expression Region

333-391aa

Organism

Homo sapiens (Human)

Target Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter; may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion; acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single-stranded 5'-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation; probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Plays also a role in the cytoplasmic TNFR1 trafficking pathways; promotes both the IL-1-beta-mediated inducible proteolytic cleavage of TNFR1 ectodomains and the release of TNFR1 exosome-like vesicles to the extracellular compartment.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter; may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion; acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single-stranded 5'-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation; probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Plays also a role in the cytoplasmic TNFR1 trafficking pathways; promotes both the IL-1-beta-mediated inducible proteolytic cleavage of TNFR1 ectodomains and the release of TNFR1 exosome-like vesicles to the extracellular compartment.

Molecular Weight

33.4 kDa

References & Citations

"hnRNP G: sequence and characterization of a glycosylated RNA-binding protein." Soulard M., Della Valle V., Siomi M., Pinol-Roma S., Codogno P., Bauvy C., Belli M., Lacroix J.-C., Monod G., Dreyfuss G., Larsen C.-J. Nucleic Acids Res. 21:4210-4217 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

4- (2-Piperidin-1-yl-ethoxy) -benzoic acid
sc-314135 500 mg

4- (2-Piperidin-1-yl-ethoxy) -benzoic acid

Ask
View Details
CD68 (Macrosialin) (MaxLight 490)
214720-ML490 100 µL

CD68 (Macrosialin) (MaxLight 490)

Ask
View Details
10µl Olympus Premium Barrier Tips
23-400 10 Racks of 96 Tips/Unit

10µl Olympus Premium Barrier Tips

Ask
View Details
MGAT4A (NM_012214) Human Untagged Clone
SC115491 10 µg

MGAT4A (NM_012214) Human Untagged Clone

Ask
View Details
ROR2, Human (HEK293, His)
HY-P71263-01 5 µg

ROR2, Human (HEK293, His)

Ask
View Details
ROR2, Human (HEK293, His)
HY-P71263-02 10 µg

ROR2, Human (HEK293, His)

Ask
View Details