Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Acyl-CoA-binding protein (Dbi)

Product Specifications

Product Name Alternative

Diazepam-binding inhibitor

Abbreviation

Recombinant Rat Dbi protein

Gene Name

Dbi

UniProt

P11030

Expression Region

2-87aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transport

Relevance

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Molecular Weight

16.9 kDa

References & Citations

"Putative diazepam binding inhibitor peptide: cDNA clones from rat." Mocchetti I., Einstein R., Brosius J. Proc. Natl. Acad. Sci. U.S.A. 83:7221-7225 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDA1 AAV Vector (Mouse) (CMV)
17767104 1 µg

DDA1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
ABCC5  Antibody
ABD7149 100 µg

ABCC5 Antibody

Sign In for Pricing
View Details
Rat OPN (Osteopontin) ELISA Kit
MBS8800541-01 48 Strip Well

Rat OPN (Osteopontin) ELISA Kit

Sign In for Pricing
View Details
Rat OPN (Osteopontin) ELISA Kit
MBS8800541-02 96 Strip Well

Rat OPN (Osteopontin) ELISA Kit

Sign In for Pricing
View Details
Rat OPN (Osteopontin) ELISA Kit
MBS8800541-03 5x 96 Strip Well

Rat OPN (Osteopontin) ELISA Kit

Sign In for Pricing
View Details
Rat OPN (Osteopontin) ELISA Kit
MBS8800541-04 10x 96 Strip Well

Rat OPN (Osteopontin) ELISA Kit

Sign In for Pricing
View Details