Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial

Product Specifications

Product Name Alternative

Protein p63

Abbreviation

Recombinant Epstein-Barr virus LMP1 protein, partial

Gene Name

LMP1

UniProt

Q1HVB3

Expression Region

185-371aa

Organism

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Target Sequence

YYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVTGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTADNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses.

Molecular Weight

24.3 kDa

References & Citations

"The genome of Epstein-Barr virus type 2 strain AG876." Dolan A., Addison C., Gatherer D., Davison A.J., McGeoch D.J. Virology 350:164-170 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-500 1x 500 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (hCGb/459), CF568 conjugate, 0.1mg/mL
BNC680211-100 1x 100 µL

HCG-beta (hCGb/459), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF568 conjugate, 0.1mg/mL
BNC682904-100 1x 100 µL

WIPI2 (2A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF594 conjugate, 0.1mg/mL
BNC941556-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details