Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Mitochondrial protein import protein mas5 (mas5)

Product Specifications

Product Name Alternative

Mas5; SPBC1734.11; Mitochondrial protein import protein mas5

Abbreviation

Recombinant SchizosaccharoMyces pombe mas5 protein

Gene Name

Mas5

UniProt

O74752

Expression Region

1-404aa

Organism

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Target Sequence

MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGHPGVQC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Probably involved in mitochondrial protein import. Plays a role in microtubule cytoskeleton organization.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probably involved in mitochondrial protein import (By similarity) . Plays a role in microtubule cytoskeleton organization.

Molecular Weight

51.5 kDa

References & Citations

"ORFeome cloning and global analysis of protein localization in the fission yeast Schizosaccharomyces pombe." Matsuyama A., Arai R., Yashiroda Y., Shirai A., Kamata A., Sekido S., Kobayashi Y., Hashimoto A., Hamamoto M., Hiraoka Y., Horinouchi S., Yoshida M. Nat. Biotechnol. 24:841-847 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDRT3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0421605 3x 1.0 µg

CDRT3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Azacosterol dihydrochloride 5mg
A13295-5 5 mg

Azacosterol dihydrochloride 5mg

Sign In for Pricing
View Details
Human RPS16 shRNA Plasmid
abx954185-01 150 µg

Human RPS16 shRNA Plasmid

Sign In for Pricing
View Details
Human RPS16 shRNA Plasmid
abx954185-02 300 µg

Human RPS16 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Bovine Myocilin (MYOC)
MBS1467823-01 0.02 mg (E-Coli)

Recombinant Bovine Myocilin (MYOC)

Sign In for Pricing
View Details
Recombinant Bovine Myocilin (MYOC)
MBS1467823-02 0.02 mg (Yeast)

Recombinant Bovine Myocilin (MYOC)

Sign In for Pricing
View Details