Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-like protein 8 (ACTL8)

Product Specifications

Product Name Alternative

Cancer/testis antigen 57 (CT57)

Abbreviation

Recombinant Human ACTL8 protein

Gene Name

ACTL8

UniProt

Q9H568

Expression Region

1-366aa

Organism

Homo sapiens (Human)

Target Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.9 kDa

References & Citations

"A human interactome in three quantitative dimensions organized by stoichiometries and abundances." Hein M.Y., Hubner N.C., Poser I., Cox J., Nagaraj N., Toyoda Y., Gak I.A., Weisswange I., Mansfeld J., Buchholz F., Hyman A.A., Mann M. Cell 163:712-723 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSDHL Rabbit Monoclonal Antibody [Clone ID: 24GB510]
TA425021 100 µL

NSDHL Rabbit Monoclonal Antibody [Clone ID: 24GB510]

Sign In for Pricing
View Details
Cortisol 21-Beta-D-Glucuronide Sodium Salt(>90%)
TRC-C696315-1MG 1 mg

Cortisol 21-Beta-D-Glucuronide Sodium Salt(>90%)

Sign In for Pricing
View Details
SUSD4 Human Gene Knockout Kit (CRISPR)
KN402622 1 Kit

SUSD4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SDHAF2 (NM_017841) Human Over-expression Lysate
LC402625 20 µg

SDHAF2 (NM_017841) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Biotin,  30nm
GAB-02-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Biotin, 30nm

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF594 conjugate, 0.1mg/mL
BNC941654-100 1x 100 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details