Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trefoil factor 3 (TFF3), partial

Product Specifications

Product Name Alternative

Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)

Abbreviation

Recombinant Human TFF3 protein, partial

Gene Name

TFF3

UniProt

Q07654

Expression Region

29-80aa

Organism

Homo sapiens (Human)

Target Sequence

LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen) .

Molecular Weight

7.5 kDa

References & Citations

"The three human trefoil genes TFF1, TFF2, and TFF3 are located within a region of 55 kb on chromosome 21q22.3." Seib T., Blin N., Hilgert K., Seifert M., Theisinger B., Engel M., Dooley S., Zang K.D., Welter C. Genomics 40:200-202 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEF1 antibody (Ser42)
70R-35964 0.1 mg

LEF1 antibody (Ser42)

Sign In for Pricing
View Details
TFF3 Rabbit Polyclonal Antibody (Fluoro647)
orb3112896 100 µg

TFF3 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
NOS3 (Ab-495) Antibody
CSB-PA064019 100 µL

NOS3 (Ab-495) Antibody

Sign In for Pricing
View Details
IGLL1 Rabbit Polyclonal Antibody (HRP)
orb471287 100 µL

IGLL1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Fbn1 shRNA (UAS) - Lentiviral mouse Fbn1 shRNA (UAS, GFP) plasmid
GTR15273322 1 Vial

Lentiviral mouse Fbn1 shRNA (UAS) - Lentiviral mouse Fbn1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Il5 shRNA (UAS) - Lentiviral mouse Il5 shRNA (UAS, RFP) (25)
GTR15267539 1 Vial

Lentiviral mouse Il5 shRNA (UAS) - Lentiviral mouse Il5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details