Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dynamin-1 (DNM1), partial

Product Specifications

Product Name Alternative

B dynamin; D100; DNM 1; DNM; DNM1; DYN1_HUMAN; Dynamin; Dynamin-1; Dynamin1

Abbreviation

Recombinant Human DNM1 protein, partial

Gene Name

DNM1

UniProt

Q05193

Expression Region

2-245aa

Organism

Homo sapiens (Human)

Target Sequence

GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.

Molecular Weight

32.2 kDa

References & Citations

Mutations in human dynamin block an intermediate stage in coated vesicle formation.van der Bliek A.M., Redelmeier T.E., Tisdale E.J., Meyerowitz E.M., Schmid S.L.J. Cell Biol. 122:553-563 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDB2 Rabbit pAb
E45R24399N-50 50 µL

DDB2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica astE Protein (aa 1-330) (strain 8081)
VAng-Cr1747-500gEcoli 500 µg (E. coli)

Recombinant Yersinia Enterocolitica astE Protein (aa 1-330) (strain 8081)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Anterior Gradient 2 (AGR2)
MBS2134938-01 0.1 mL

PE Linked Monoclonal Antibody to Anterior Gradient 2 (AGR2)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Anterior Gradient 2 (AGR2)
MBS2134938-02 0.2 mL

PE Linked Monoclonal Antibody to Anterior Gradient 2 (AGR2)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Anterior Gradient 2 (AGR2)
MBS2134938-03 0.5 mL

PE Linked Monoclonal Antibody to Anterior Gradient 2 (AGR2)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Anterior Gradient 2 (AGR2)
MBS2134938-04 1 mL

PE Linked Monoclonal Antibody to Anterior Gradient 2 (AGR2)

Sign In for Pricing
View Details