Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Rhodopsin (RHO), partial

Product Specifications

Product Name Alternative

RHO1

Abbreviation

Recombinant Pig RHO protein, partial

Gene Name

RHO

UniProt

O18766

Expression Region

1-36aa

Organism

Sus scrofa (Pig)

Target Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth

Molecular Weight

31.2 kDa

References & Citations

"Structural and functional protein network analyses predict novel signaling functions for rhodopsin." Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Mol. Syst. Biol. 7:551-551 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCEM1 rabbit pAb
ES11165-01 50 µL

MCEM1 rabbit pAb

Sign In for Pricing
View Details
MCEM1 rabbit pAb
ES11165-02 100 µL

MCEM1 rabbit pAb

Sign In for Pricing
View Details
HLEB-3 Cell Line
T9729 1x106 cells / 1.0 mL

HLEB-3 Cell Line

Sign In for Pricing
View Details
CD26 Antibody
MBS8582766-01 0.1 mL

CD26 Antibody

Sign In for Pricing
View Details
CD26 Antibody
MBS8582766-02 0.1 mL (AF635)

CD26 Antibody

Sign In for Pricing
View Details
CD26 Antibody
MBS8582766-03 0.1 mL (AF610)

CD26 Antibody

Sign In for Pricing
View Details