Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Rhodopsin (RHO), partial

Product Specifications

Product Name Alternative

RHO1

Abbreviation

Recombinant Pig RHO protein, partial

Gene Name

RHO

UniProt

O18766

Expression Region

1-36aa

Organism

Sus scrofa (Pig)

Target Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth

Molecular Weight

34.2 kDa

References & Citations

"Structural and functional protein network analyses predict novel signaling functions for rhodopsin." Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Mol. Syst. Biol. 7:551-551 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Recombinant Rabbit monoclonal Antibody
HA723170 100 µL

CD40 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Foxp3 Antibody[3G3]
E-AB-F1238M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse Foxp3 Antibody[3G3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Foxp3 Antibody[3G3]
E-AB-F1238M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse Foxp3 Antibody[3G3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Foxp3 Antibody[3G3]
E-AB-F1238M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse Foxp3 Antibody[3G3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS707632 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842S-01 20 Tests

Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details