Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gamma-crystallin B (CRYGB)

Product Specifications

Product Name Alternative

Gamma-B-crystallin (Gamma-crystallin 1-2) (CRYG2)

Abbreviation

Recombinant Human CRYGB protein

Gene Name

CRYGB

UniProt

P07316

Expression Region

1-175aa

Organism

Homo sapiens (Human)

Target Sequence

MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Crystallins are the dominant structural components of the vertebrate eye lens.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Crystallins are the dominant structural components of the vertebrate eye lens.

Molecular Weight

24.9 kDa

References & Citations

"Two human gamma-crystallin genes are linked and riddled with Alu-repeats." den Dunnen J.T., Moormann R.J.M., Cremers F.P.M., Schoenmakers J.G.G. Gene 38:197-204 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STT3A Human Gene Knockout Kit (CRISPR)
KN401991 1 Kit

STT3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PAPOLB activation kit by CRISPRa
GA111256 1 Kit

Human PAPOLB activation kit by CRISPRa

Sign In for Pricing
View Details
DIABLO Mouse Monoclonal Antibody [Clone ID: AT19F2]
AM50051PU-N 100 µL

DIABLO Mouse Monoclonal Antibody [Clone ID: AT19F2]

Sign In for Pricing
View Details
1810007E14Rik (BC031454) Mouse Tagged ORF Clone
MG200233 10 µg

1810007E14Rik (BC031454) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GXYLT1 Human qPCR Primer Pair (NM_173601)
HP229438 200 Reactions

GXYLT1 Human qPCR Primer Pair (NM_173601)

Sign In for Pricing
View Details