Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early growth response protein 1 (EGR1), partial

Product Specifications

Product Name Alternative

AT225 (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24) (KROX24) (ZNF225)

Abbreviation

Recombinant Human EGR1 protein, partial

Gene Name

EGR1

UniProt

P18146

Expression Region

444-543aa

Organism

Homo sapiens (Human)

Target Sequence

SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3' (EGR-site) . Activates the transcription of target genes whose products are required for mitogenesis and differentiation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcriptional regulator

Molecular Weight

24.1 kDa

References & Citations

CDNA sequence of the human cellular early growth response gene Egr-1.Suggs S.V., Katzowitz J.L., Tsai-Morris C.-H., Sukhatme V.P.Nucleic Acids Res. 18:4283-4283 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-SARS-CoV-2 S/Spike glycoprotein IgA Antibody (SAA2227)
RVV00326 100 μg

Mouse Anti-SARS-CoV-2 S/Spike glycoprotein IgA Antibody (SAA2227)

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1 (K417N, E484K, N501Y, D614G) Protein (His Tag), Biotinylated
E45O55224M2-20 20 µg

SARS-CoV-2 Spike S1 (K417N, E484K, N501Y, D614G) Protein (His Tag), Biotinylated

Sign In for Pricing
View Details
TGR5 agonist 5
orb3134805-01 50 mg

TGR5 agonist 5

Sign In for Pricing
View Details
TGR5 agonist 5
orb3134805-02 10 mg

TGR5 agonist 5

Sign In for Pricing
View Details
TSEN2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-9735R-BF750 100 µL

TSEN2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
NAP1L1 Human siRNA Oligo Duplex (Locus ID 4673)
SR303074 1 Kit

NAP1L1 Human siRNA Oligo Duplex (Locus ID 4673)

Sign In for Pricing
View Details