Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial

Product Specifications

Product Name Alternative

Apoptosis regulator Bcl 2; Apoptosis regulator Bcl-2; Apoptosis regulator Bcl2; AW986256; B cell CLL/lymphoma 2; B cell leukemia/lymphoma 2; Bcl-2; Bcl2; BCL2_HUMAN; C430015F12Rik; D630044D05Rik; D830018M01Rik; Leukemia/lymphoma; B-cell; 2; Oncogene B-cell leukemia 2; PPP1R50; Protein phosphatase 1 regulatory subunit 50; Protein phosphatase 1; regulatory subunit 50

Abbreviation

Recombinant Human BCL2 protein, partial

Gene Name

BCL2

UniProt

P10415

Expression Region

2-211aa

Organism

Homo sapiens (Human)

Target Sequence

AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) . May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) . May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release

Molecular Weight

25.2 kDa

References & Citations

"Analysis of the structure, transcripts, and protein products of bcl-2, the gene involved in human follicular lymphoma." Tsujimoto Y., Croce C.M. Proc. Natl. Acad. Sci. U.S.A. 83:5214-5218 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human CTSD Antibody Pair Set
E-KAB-0504 50 μL & 100 μg

Human CTSD Antibody Pair Set

Ask
View Details
Sgcz 3'UTR Lenti-reporter-Luc Vector
43624084 1.0 μg

Sgcz 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
CLIA Kit for Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
SCA552Hu-01 24 Tests

CLIA Kit for Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Ask
View Details
CLIA Kit for Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
SCA552Hu-02 48 Tests

CLIA Kit for Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Ask
View Details
CLIA Kit for Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
SCA552Hu-03 96 Tests

CLIA Kit for Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Ask
View Details
CLIA Kit for Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
SCA552Hu-04 5x 96 Tests

CLIA Kit for Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Ask
View Details