Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptomyces globisporus Lysozyme M1 (acm)

Product Specifications

Product Name Alternative

1,4-beta-N-acetylmuramidase M1

Abbreviation

Recombinant Streptomyces globisporus acm protein

Gene Name

Acm

UniProt

P25310

Expression Region

78-294aa

Organism

Streptomyces globisporus

Target Sequence

DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.

Molecular Weight

30.6 kDa

References & Citations

"A new lysozyme fold. Crystal structure of the muramidase from Streptomyces coelicolor at 1.65 A resolution." Rau A., Hogg T., Marquardt R., Hilgenfeld R. J. Biol. Chem. 276:31994-31999 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pack of 100 board filter discs 390g/m², 125 mm
FT203A0125 Pack of 100

Pack of 100 board filter discs 390g/m², 125 mm

Sign In for Pricing
View Details
Human CCL19 Protein, hFc Tag
TP724462 100 µg

Human CCL19 Protein, hFc Tag

Sign In for Pricing
View Details
Caveolin 1 (Caveolin-1, CAV 1, CAV1, CAV-1, CAV, Caveolae Protein 22kD, Cell Growth-inhibiting Protein 32, HGNC:1527, MSTP085, OTTHUMP00000025031, VIP21) (MaxLight 650) discontinued
C2097-91T-ML650 100 µL

Caveolin 1 (Caveolin-1, CAV 1, CAV1, CAV-1, CAV, Caveolae Protein 22kD, Cell Growth-inhibiting Protein 32, HGNC:1527, MSTP085, OTTHUMP00000025031, VIP21) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus rod-shaped virus 1 Putative capsid protein (134)
MBS1321912-01 0.02 mg (E-Coli)

Recombinant Sulfolobus islandicus rod-shaped virus 1 Putative capsid protein (134)

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus rod-shaped virus 1 Putative capsid protein (134)
MBS1321912-02 0.1 mg (E-Coli)

Recombinant Sulfolobus islandicus rod-shaped virus 1 Putative capsid protein (134)

Sign In for Pricing
View Details
Recombinant Sulfolobus islandicus rod-shaped virus 1 Putative capsid protein (134)
MBS1321912-03 0.02 mg (Yeast)

Recombinant Sulfolobus islandicus rod-shaped virus 1 Putative capsid protein (134)

Sign In for Pricing
View Details