Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Trans-activator protein BZLF1 (BZLF1)

Product Specifications

Product Name Alternative

Zebra

Abbreviation

Recombinant Epstein-Barr virus BZLF1 protein

Gene Name

BZLF1

UniProt

Q3KSS8

Expression Region

1-245aa

Organism

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Target Sequence

MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSAAPTGSWFPAPQPAPENAYQAYAAPQLFPVSDITQNQLTNQAGGEAPQPGDNSTVQPAAAVVLACPGANQEQQLADIGAPQPAPAAAPARRTRKPLQPESLEECDSELEIKRYKNRVASRKCRAKFKHLLQHYREVASAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1) (By similarity) .

Molecular Weight

33.8 kDa

References & Citations

"New BZLF1 sequence variations in EBV-associated undifferentiated nasopharyngeal carcinoma in southern China." Ji K.-M., Li C.-L., Meng G., Han A.-D., Wu X.-L. Arch. Virol. 153:1949-1953 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR pTyr1092 Rabbit Polyclonal Antibody
AP02379PU-N 100 µL

EGFR pTyr1092 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD21 Antibody
KC-2416-01 50 μL

CD21 Antibody

Sign In for Pricing
View Details
CD21 Antibody
KC-2416-02 100 µL

CD21 Antibody

Sign In for Pricing
View Details
CD21 Antibody
KC-2416-03 1 mL

CD21 Antibody

Sign In for Pricing
View Details
Citric Acid (CA) Colorimetric Assay Kit
E-BC-K351-M-01 48 T (32 samples)

Citric Acid (CA) Colorimetric Assay Kit

Sign In for Pricing
View Details
Citric Acid (CA) Colorimetric Assay Kit
E-BC-K351-M-02 96 T (80 samples)

Citric Acid (CA) Colorimetric Assay Kit

Sign In for Pricing
View Details