Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein S100-A4 (S100a4)

Product Specifications

Product Name Alternative

Metastasin (Nerve growth factor-induced protein 42A) (P9K) (Placental calcium-binding protein) (S100 calcium-binding protein A4)

Abbreviation

Recombinant Rat S100a4 protein

Gene Name

S100a4

UniProt

P05942

Expression Region

2-101aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.6 kDa

References & Citations

"Nerve growth factor induces the genes for two proteins related to a family of calcium-binding proteins in PC12 cells." Masiakowski P., Shooter E.M. Proc. Natl. Acad. Sci. U.S.A. 85:1277-1281 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast, right
CR561878 5 µg

Tissue Total RNA, Breast, right

Sign In for Pricing
View Details
Ptpn11 Mouse Gene Knockout Kit (CRISPR)
KN314207BN 1 Kit

Ptpn11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STK25 Human Gene Knockout Kit (CRISPR)
KN203215 1 Kit

STK25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC/Cy7 Anti-human CD4 Antibody *RPA-T4*
100411D0-AAT 25 Tests

APC/Cy7 Anti-human CD4 Antibody *RPA-T4*

Sign In for Pricing
View Details
Cadherin like 23 (CDH23) (61-110) Rabbit Polyclonal Antibody
AP31877PU-N 50 µL

Cadherin like 23 (CDH23) (61-110) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details