Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neutrophil defensin 3 (DEFA3), partial

Product Specifications

Product Name Alternative

Defensin, alpha 3 (HNP-3) (HP-3) (HP3) (HP 3-56) (Neutrophil defensin 2) (HNP-2) (HP-2) (HP2) (DEF3)

Abbreviation

Recombinant Human DEFA3 protein, partial

Gene Name

DEFA3

UniProt

P59666

Expression Region

39-94aa

Organism

Homo sapiens (Human)

Target Sequence

DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Molecular Weight

22.4 kDa

References & Citations

"Differentiation stage-specific expression of a gene during granulopoiesis." Wiedemann L.M., Francis G.E., Lamb R.F., Burns J.H., Winnie J.N., McKenzie E.D., Birnie G.D. Leukemia 3:227-234 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1110032F04Rik CRISPR Activation Plasmid (m)
sc-427154-ACT 20 µg

1110032F04Rik CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
TAF4 Rabbit Polyclonal Antibody
orb665726-01 30 µL

TAF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAF4 Rabbit Polyclonal Antibody
orb665726-02 50 μL

TAF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAF4 Rabbit Polyclonal Antibody
orb665726-03 100 µL

TAF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAF4 Rabbit Polyclonal Antibody
orb665726-04 200 µL

TAF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MC5R knockdown cell line
ABC-KD9099 1 Vial

Human MC5R knockdown cell line

Sign In for Pricing
View Details