Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Small proline-rich protein 2B (Sprr2b)

Product Specifications

Product Name Alternative

Sprr2bSmall proline-rich protein 2B

Abbreviation

Recombinant Mouse Sprr2b protein

Gene Name

Sprr2b

UniProt

O70554

Expression Region

1-98aa

Organism

Mus musculus (Mouse)

Target Sequence

MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity) .

Molecular Weight

17.7 kDa

References & Citations

"Mouse Sprr2 genes: a clustered family of genes showing differential expression in epithelial tissues." Song H.J., Poy G., Darwiche N., Lichti U., Kuroki T., Steinert P.M., Kartasova T. Genomics 55:28-42 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CytoLinerTM 410/450 Fixed Cell Membrane Stain, 1000 labelings
#30131 1 Kit

CytoLinerTM 410/450 Fixed Cell Membrane Stain, 1000 labelings

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF640R conjugate, 0.1mg/mL
BNC402701-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Coumaphos-d10
TRC-C745302-1MG 1 mg

Coumaphos-d10

Sign In for Pricing
View Details
Recombinant Prothrombin Monoclonal Antibody
AN301787L-01 50 µL

Recombinant Prothrombin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Prothrombin Monoclonal Antibody
AN301787L-02 100 µL

Recombinant Prothrombin Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Macrophage Derived Chemokine (MDC) ELISA Kit
RDR-MDC-Mu-01 96 Tests

Mouse Macrophage Derived Chemokine (MDC) ELISA Kit

Sign In for Pricing
View Details