Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Serum amyloid A protein (SAA1)

Product Specifications

Product Name Alternative

Amyloid fibril protein AA (SAA)

Abbreviation

Recombinant Bovine SAA1 protein

Gene Name

SAA1

UniProt

P35541

Expression Region

19-130aa

Organism

Bos taurus (Bovine)

Target Sequence

QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major acute phase reactant. Apolipoprotein of the HDL complex.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major acute phase reactant. Apolipoprotein of the HDL complex.

Molecular Weight

30.1 kDa

References & Citations

"A unique insertion in the primary structure of bovine amyloid AA protein." Benson M.D., Dibartola S.P., Dwulet F.E. J. Lab. Clin. Med. 113:67-72 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora B (AURKB) Rabbit Monoclonal Antibody
TA422189 100 µL

Aurora B (AURKB) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MAB21L3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F6]
TA502716AM 100 µL

MAB21L3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F6]

Sign In for Pricing
View Details
Human ARID3C activation kit by CRISPRa
GA115313 1 Kit

Human ARID3C activation kit by CRISPRa

Sign In for Pricing
View Details
CD88 / C5R1 Rat Monoclonal Antibody [Clone ID: 10/92]
AM01269PU-S 100 µg

CD88 / C5R1 Rat Monoclonal Antibody [Clone ID: 10/92]

Sign In for Pricing
View Details
PCPTP1 (PTPRR) (NM_002849) Human Recombinant Protein
TP312896L 1 mg

PCPTP1 (PTPRR) (NM_002849) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS714773 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details