Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Serum amyloid A protein (SAA1)

Product Specifications

Product Name Alternative

Amyloid fibril protein AA

Abbreviation

Recombinant Horse SAA1 protein

Gene Name

SAA1

UniProt

P19857

Expression Region

1-110aa

Organism

Equus caballus (Horse)

Target Sequence

LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major acute phase reactant. Apolipoprotein of the HDL complex.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major acute phase reactant. Apolipoprotein of the HDL complex.

Molecular Weight

15.8 kDa

References & Citations

The amino acid sequence of an amyloid fibril protein AA isolated from the horse.Sletten K., Husebekk A., Husby G.Scand. J. Immunol. 26:79-84 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldehyde Oxidase (AOX1) (NM_001159) Human Mass Spec Standard
PH319221 10 µg

Aldehyde Oxidase (AOX1) (NM_001159) Human Mass Spec Standard

Sign In for Pricing
View Details
Rat CD44 antigen,Cd44 ELISA KIT
ELI-02344r 96 Tests

Rat CD44 antigen,Cd44 ELISA KIT

Sign In for Pricing
View Details
Gemin8 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4298604 1.0 µg DNA

Gemin8 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Conus catus Mu-conotoxin CIIIA
MBS1059966-01 0.05 mg (E-Coli)

Recombinant Conus catus Mu-conotoxin CIIIA

Sign In for Pricing
View Details
Recombinant Conus catus Mu-conotoxin CIIIA
MBS1059966-02 0.2 mg (E-Coli)

Recombinant Conus catus Mu-conotoxin CIIIA

Sign In for Pricing
View Details
Recombinant Conus catus Mu-conotoxin CIIIA
MBS1059966-03 0.5 mg (E-Coli)

Recombinant Conus catus Mu-conotoxin CIIIA

Sign In for Pricing
View Details