Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Serum amyloid A protein (SAA1)

Product Specifications

Product Name Alternative

Amyloid fibril protein AA

Abbreviation

Recombinant Horse SAA1 protein

Gene Name

SAA1

UniProt

P19857

Expression Region

1-110aa

Organism

Equus caballus (Horse)

Target Sequence

LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major acute phase reactant. Apolipoprotein of the HDL complex.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major acute phase reactant. Apolipoprotein of the HDL complex.

Molecular Weight

15.8 kDa

References & Citations

The amino acid sequence of an amyloid fibril protein AA isolated from the horse.Sletten K., Husebekk A., Husby G.Scand. J. Immunol. 26:79-84 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBCA, NT (TBCA, Tubulin-specific chaperone A, TCP1-chaperonin cofactor A, Tubulin-folding cofactor A) (PE)
MBS6353995-01 0.2 mL

TBCA, NT (TBCA, Tubulin-specific chaperone A, TCP1-chaperonin cofactor A, Tubulin-folding cofactor A) (PE)

Sign In for Pricing
View Details
TBCA, NT (TBCA, Tubulin-specific chaperone A, TCP1-chaperonin cofactor A, Tubulin-folding cofactor A) (PE)
MBS6353995-02 5x 0.2 mL

TBCA, NT (TBCA, Tubulin-specific chaperone A, TCP1-chaperonin cofactor A, Tubulin-folding cofactor A) (PE)

Sign In for Pricing
View Details
LOC105369261 mouse monoclonal antibody, clone DFT-1, PE
SM1793R 100 Tests

LOC105369261 mouse monoclonal antibody, clone DFT-1, PE

Sign In for Pricing
View Details
Cntn4 (NM_053879) Rat Tagged Lenti ORF Clone
RR208421L4 10 µg

Cntn4 (NM_053879) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Anti-KLH IgG (Keyhole Limpet Hemocyanin IgG) ELISA Kit
MBS7615564-01 48 Well

Rat Anti-KLH IgG (Keyhole Limpet Hemocyanin IgG) ELISA Kit

Sign In for Pricing
View Details
Rat Anti-KLH IgG (Keyhole Limpet Hemocyanin IgG) ELISA Kit
MBS7615564-02 96 Well

Rat Anti-KLH IgG (Keyhole Limpet Hemocyanin IgG) ELISA Kit

Sign In for Pricing
View Details