Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3)

Product Specifications

Product Name Alternative

Adenylate kinase 3 (AK 3) (Adenylate kinase 3 alpha-like 1) (AK3L1) (AK6) (AKL3L)

Abbreviation

Recombinant Human AK3 protein

Gene Name

AK3

UniProt

Q9UIJ7

Expression Region

1-227aa

Organism

Homo sapiens (Human)

Target Sequence

MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP

Molecular Weight

32.6 kDa

References & Citations

"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome." Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H. J. Proteomics 96:253-262 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMCX5 Human shRNA Plasmid Kit (Locus ID 64860)
TL306573 1 Kit

ARMCX5 Human shRNA Plasmid Kit (Locus ID 64860)

Sign In for Pricing
View Details
RPS2P5 sgRNA CRISPR Lentivector (Human) (Target 3)
K1999504 1.0 µg DNA

RPS2P5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Research Grade Bavituximab
YP862016-01 100 µg

Research Grade Bavituximab

Sign In for Pricing
View Details
Research Grade Bavituximab
YP862016-02 1 mg

Research Grade Bavituximab

Sign In for Pricing
View Details
PRKRIRP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV773187 1.0 µg DNA

PRKRIRP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Donkey Anti-Goat IgG (H+L) PerCP
F0124 100 Tests

Donkey Anti-Goat IgG (H+L) PerCP

Sign In for Pricing
View Details