Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interleukin-4 (IL4)

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1 (BSF-1) (Lymphocyte stimulatory factor 1)

Abbreviation

Recombinant Cynomolgus monkey IL4 protein

Gene Name

IL4

UniProt

P79339

Expression Region

25-153aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Molecular Weight

18.9 kDa

References & Citations

"Cloning of interleukin-4 delta2 splice variant (IL-4delta2) in chimpanzee and cynomolgus macaque: phylogenetic analysis of delta2 splice variant appearance, and implications for the study of IL-4-driven immune processes."Gautherot I., Burdin N., Seguin D., Aujame L., Sodoyer R.Immunogenetics 54:635-644 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FADS6 Antibody Blocking peptide
orb1459207 500 µg

FADS6 Antibody Blocking peptide

Sign In for Pricing
View Details
Anti-CDC34 Antibody
MBS9239079-01 0.05 mL

Anti-CDC34 Antibody

Sign In for Pricing
View Details
Anti-CDC34 Antibody
MBS9239079-02 0.1 mL

Anti-CDC34 Antibody

Sign In for Pricing
View Details
Anti-CDC34 Antibody
MBS9239079-03 5x 0.1 mL

Anti-CDC34 Antibody

Sign In for Pricing
View Details
Cotinine 4 (AP) discontinued
C7904-50A-AP 100 µL

Cotinine 4 (AP) discontinued

Sign In for Pricing
View Details
ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (MaxLight 490)
MBS6201804-01 0.1 mL

ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (MaxLight 490)

Sign In for Pricing
View Details