Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostaglandin E synthase 3 (PTGES3)

Product Specifications

Product Name Alternative

Cytosolic prostaglandin E2 synthase (cPGES) (Hsp90 co-chaperone) (Progesterone receptor complex p23) (Telomerase-binding protein p23)

Abbreviation

Recombinant Human PTGES3 protein

Gene Name

PTGES3

UniProt

Q15185

Expression Region

1-160aa

Organism

Homo sapiens (Human)

Target Sequence

MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) . Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2)

Molecular Weight

24.2 kDa

References & Citations

"Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line." Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S. Electrophoresis 28:2027-2034 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISL1 antibody
BF0164 100 µg

ISL1 antibody

Sign In for Pricing
View Details
Recombinant Human MPHOSPH8
orb1099266-01 50 µg

Recombinant Human MPHOSPH8

Sign In for Pricing
View Details
Recombinant Human MPHOSPH8
orb1099266-02 100 µg

Recombinant Human MPHOSPH8

Sign In for Pricing
View Details
Recombinant Human MPHOSPH8
orb1099266-03 200 µg

Recombinant Human MPHOSPH8

Sign In for Pricing
View Details
Recombinant Human MPHOSPH8
orb1099266-04 1 mg

Recombinant Human MPHOSPH8

Sign In for Pricing
View Details
Human KIAA1614 shRNA Plasmid
abx961651-01 150 µg

Human KIAA1614 shRNA Plasmid

Sign In for Pricing
View Details