Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse S-arrestin (Sag)

Product Specifications

Product Name Alternative

48 kDa protein (Retinal S-antigen) (S-AG) (Rod photoreceptor arrestin)

Abbreviation

Recombinant Mouse Sag protein

Gene Name

Sag

UniProt

P20443

Expression Region

1-403aa

Organism

Mus musculus (Mouse)

Target Sequence

MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLKDTGENTEGKKDEDAGQDE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO

Molecular Weight

50.4 kDa

References & Citations

"Deactivation of phosphorylated and nonphosphorylated rhodopsin by arrestin splice variants." Burns M.E., Mendez A., Chen C.K., Almuete A., Quillinan N., Simon M.I., Baylor D.A., Chen J. J. Neurosci. 26:1036-1044 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit
orb1663891-01 48 Tests

Rat Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit

Sign In for Pricing
View Details
Rat Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit
orb1663891-02 96 Tests

Rat Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal SSX1 Antibody (OTI1E10) [PerCP]
NBP2-74362PCP 0.1 mL

Mouse Monoclonal SSX1 Antibody (OTI1E10) [PerCP]

Sign In for Pricing
View Details
Rabbit Polyclonal Cytokeratin 6a Antibody [DyLight 594]
NBP2-97405DL594 0.1 mL

Rabbit Polyclonal Cytokeratin 6a Antibody [DyLight 594]

Sign In for Pricing
View Details
1-Benzyl 4'-tert-butyl 1H-spiro[azetidine-3,3'-[1,4]benzoxazepine]-1,4' (5'H) -dicarboxylate
OR52683 1 Each

1-Benzyl 4'-tert-butyl 1H-spiro[azetidine-3,3'-[1,4]benzoxazepine]-1,4' (5'H) -dicarboxylate

Sign In for Pricing
View Details
Rat Nit1 Pre-designed siRNA Set B
SI209323B 1 Each

Rat Nit1 Pre-designed siRNA Set B

Sign In for Pricing
View Details