Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse S-arrestin (Sag)

Product Specifications

Product Name Alternative

48 kDa protein (Retinal S-antigen) (S-AG) (Rod photoreceptor arrestin)

Abbreviation

Recombinant Mouse Sag protein

Gene Name

Sag

UniProt

P20443

Expression Region

1-403aa

Organism

Mus musculus (Mouse)

Target Sequence

MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLKDTGENTEGKKDEDAGQDE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO

Molecular Weight

50.4 kDa

References & Citations

"Deactivation of phosphorylated and nonphosphorylated rhodopsin by arrestin splice variants." Burns M.E., Mendez A., Chen C.K., Almuete A., Quillinan N., Simon M.I., Baylor D.A., Chen J. J. Neurosci. 26:1036-1044 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC4M Antibody
GWB-MP141F 50 µg

CLEC4M Antibody

Sign In for Pricing
View Details
Anti-BEX3 Polyclonal Antibody
HA759014-01 50 µg

Anti-BEX3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-BEX3 Polyclonal Antibody
HA759014-02 100 µg

Anti-BEX3 Polyclonal Antibody

Sign In for Pricing
View Details
Stabilin1 Rabbit Polyclonal Antibody (PE-Cy5)
orb872235 100 µL

Stabilin1 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Anti-RbAp48 Antibody
3110 1 Each

Anti-RbAp48 Antibody

Sign In for Pricing
View Details
ZBTB10, CT (ZBTB10, RINZF, RINZFC, Zinc finger and BTB domain-containing protein 10, Zinc finger protein RIN ZF) (MaxLight 750) discontinued
043990-ML750 100 µL

ZBTB10, CT (ZBTB10, RINZF, RINZFC, Zinc finger and BTB domain-containing protein 10, Zinc finger protein RIN ZF) (MaxLight 750) discontinued

Sign In for Pricing
View Details