Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Laminin subunit beta-1 (LAMB1), partial

Product Specifications

Product Name Alternative

Laminin B1 chain (Laminin-1 subunit beta) (Laminin-10 subunit beta) (Laminin-12 subunit beta) (Laminin-2 subunit beta) (Laminin-6 subunit beta) (Laminin-8 subunit beta)

Abbreviation

Recombinant Human LAMB1 protein, partial

Gene Name

LAMB1

UniProt

P07942

Expression Region

1533-1782aa

Organism

Homo sapiens (Human)

Target Sequence

MPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVY

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basement membrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basement membrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.

Molecular Weight

44.3 kDa

References & Citations

"Human laminin B1 chain. A multidomain protein with gene (LAMB1) locus in the q22 region of chromosome 7." Pikkarainen T., Eddy R., Fukushima Y., Byers M., Shows T., Pihlajaniemi T., Saraste M., Tryggvason K. J. Biol. Chem. 262:10454-10462 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Rat CNTF (Ciliary Neurotrophic Factor) ELISA Kit
E-UNEL-R0068-01 5x 96 Tests

Uncoated Rat CNTF (Ciliary Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat CNTF (Ciliary Neurotrophic Factor) ELISA Kit
E-UNEL-R0068-02 15x 96 Tests

Uncoated Rat CNTF (Ciliary Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Human RIOK2 activation kit by CRISPRa
GA110964 1 Kit

Human RIOK2 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Mercaptobenzoic Acid, Technical Grade
TRC-M252500-5G 5 g

4-Mercaptobenzoic Acid, Technical Grade

Sign In for Pricing
View Details
Med18 (NM_026039) Mouse Tagged ORF Clone
MG202211 10 µg

Med18 (NM_026039) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TTPAL (NM_001039199) Human Over-expression Lysate
LY422027 100 µg

TTPAL (NM_001039199) Human Over-expression Lysate

Sign In for Pricing
View Details