Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine RISC-loading complex subunit TARBP2 (TARBP2)

Product Specifications

Product Name Alternative

TARBP2; RISC-loading complex subunit TARBP2

Abbreviation

Recombinant Bovine TARBP2 protein

Gene Name

TARBP2

UniProt

Q0IIG6

Expression Region

1-366aa

Organism

Bos taurus (Bovine)

Target Sequence

MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDVPVFTAAAAATPVPSAVPTRSSPMEVQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEAEPEDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCSVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSAATREAARGEAARRALQYLKIMAGSK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Required for formation of the RNA induced silencing complex (RISC) . Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for formation of the RNA induced silencing complex (RISC) . Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1.

Molecular Weight

45.8 kDa

References & Citations

"Sequence evaluation of four pooled-tissue normalized bovine cDNA libraries and construction of a gene index for cattle." Smith T.P.L., Grosse W.M., Freking B.A., Roberts A.J., Stone R.T., Casas E., Wray J.E., White J., Cho J., Fahrenkrug S.C., Bennett G.L., Heaton M.P., Laegreid W.W., Rohrer G.A., Chitko-McKown C.G., Pertea G., Holt I., Karamycheva S. Keele J.W. Genome Res. 11:626-630 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Collagen Type II (ABT163) Antibody
W0333-01 20 µL

Collagen Type II (ABT163) Antibody

Ask
View Details
Collagen Type II (ABT163) Antibody
W0333-02 50 µL

Collagen Type II (ABT163) Antibody

Ask
View Details
Collagen Type II (ABT163) Antibody
W0333-03 100 µL

Collagen Type II (ABT163) Antibody

Ask
View Details
Collagen Type II (ABT163) Antibody
W0333-04 200 μL

Collagen Type II (ABT163) Antibody

Ask
View Details
Rabbit anti-CDC16 Antibody
YLD1665-01 50 µL

Rabbit anti-CDC16 Antibody

Ask
View Details
Rabbit anti-CDC16 Antibody
YLD1665-02 100 µL

Rabbit anti-CDC16 Antibody

Ask
View Details