Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Beta-2-microglobulin (B2M)

Product Specifications

Product Name Alternative

B2MBeta-2-microglobulin

Abbreviation

Recombinant Sheep B2M protein

Gene Name

B2M

UniProt

Q6QAT4

Expression Region

21-118aa

Organism

Ovis aries (Sheep)

Target Sequence

IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Component of the class I major histocompatibility complex (MHC) . Involved in the presentation of peptide antigens to the immune system

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of the class I major histocompatibility complex (MHC) . Involved in the presentation of peptide antigens to the immune system (By similarity) .

Molecular Weight

18.6 kDa

References & Citations

"Ovine beta-2 microglobulin." O'Brien R., Berger S., Griffin F. Submitted (FEB-2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL27A Peptide - C-terminal region (AAP65487)
AAP65487-100UG 100 µg

RPL27A Peptide - C-terminal region (AAP65487)

Sign In for Pricing
View Details
PRDM5 Antibody - N-terminal region : HRP (ARP39376_P050-HRP)
ARP39376_P050-HRP 100 µL

PRDM5 Antibody - N-terminal region : HRP (ARP39376_P050-HRP)

Sign In for Pricing
View Details
Bovine DNA damage-binding protein 1, DDB1 ELISA Kit
MBS9321092-01 48 Well

Bovine DNA damage-binding protein 1, DDB1 ELISA Kit

Sign In for Pricing
View Details
Bovine DNA damage-binding protein 1, DDB1 ELISA Kit
MBS9321092-02 96 Well

Bovine DNA damage-binding protein 1, DDB1 ELISA Kit

Sign In for Pricing
View Details
Bovine DNA damage-binding protein 1, DDB1 ELISA Kit
MBS9321092-03 5x 96 Well

Bovine DNA damage-binding protein 1, DDB1 ELISA Kit

Sign In for Pricing
View Details
Bovine DNA damage-binding protein 1, DDB1 ELISA Kit
MBS9321092-04 10x 96 Well

Bovine DNA damage-binding protein 1, DDB1 ELISA Kit

Sign In for Pricing
View Details