Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heron hepatitis B virus Protein P (P), partial

Product Specifications

Product Name Alternative

P; Protein P [Includes: DNA-directed DNA polymerase; EC 2.7.7.7) ; RNA-directed DNA polymerase; EC 2.7.7.49) ; Ribonuclease H; EC 3.1.26.4) ]

Abbreviation

Recombinant Heron hepatitis B virus protein P, partial

Gene Name

P

UniProt

P13846

Expression Region

376-565aa

Organism

Heron hepatitis B virus (HHBV)

Target Sequence

SYLRGNTSWPNRVTGRIFLVDKNSRNTEEARLVVDFSQFSKGKNAMRFPKYWCPNLTTLRRILPVGMPRISLDLSQAFYHLPLAPASSSRLAVSDGKQVYYFRKAPMGVGLSPFLLHLFTTAIGAEIASRFNVWTFSYMDDFLLCHPSARHLNTISHAVCTFLQEFGIRINFDKMTPSPVTTIRFLGYEI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3'- to 5'-endonucleasic mode. Neo-synthesized pregenomic RNA (pgRNA) are encapsidated together with the P protein, and reverse-transcribed inside the nucleocapsid. Initiation of reverse-transcription occurs first by binding the epsilon loop on the pgRNA genome, and is initiated by protein priming, thereby the 5'-end of (-) DNA is covalently linked to P protein. Partial (+) DNA is synthesized from the (-) DNA template and generates the relaxed circular DNA (RC-DNA) genome. After budding and infection, the RC-DNA migrates in the nucleus, and is converted into a plasmid-like covalently closed circular DNA (cccDNA) . The activity of P protein does not seem to be necessary for cccDNA generation, and is presumably released from (+) DNA by host nuclear DNA repair machinery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3'- to 5'-endonucleasic mode. Neo-synthesized pregenomic RNA (pgRNA) are encapsidated together with the P protein, and reverse-transcribed inside the nucleocapsid. Initiation of reverse-transcription occurs first by binding the epsilon loop on the pgRNA genome, and is initiated by protein priming, thereby the 5'-end of (-) DNA is covalently linked to P protein. Partial (+) DNA is synthesized from the (-) DNA template and generates the relaxed circular DNA (RC-DNA) genome. After budding and infection, the RC-DNA migrates in the nucleus, and is converted into a plasmid-like covalently closed circular DNA (cccDNA) . The activity of P protein does not seem to be necessary for cccDNA generation, and is presumably released from (+) DNA by host nuclear DNA repair machinery (By similarity) .

Molecular Weight

28.7 kDa

References & Citations

"Isolation and characterization of a hepatitis B virus endemic in herons." Sprengel R., Kaleta E.F., Will H. J. Virol. 62:3832-3839 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF740 conjugate, 0.1mg/mL
BNC741729-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Equine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit
RD-TGFb1-Eq-01 96 Tests

Equine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit

Sign In for Pricing
View Details
Equine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit
RD-TGFb1-Eq-02 48 Tests

Equine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit

Sign In for Pricing
View Details
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Over-expression Lysate
LY419561 100 µg

G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific
FAF-521-1 1 mL

FITC Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific

Sign In for Pricing
View Details
B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: OTI11G5]
CF812246 100 µg

B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: OTI11G5]

Sign In for Pricing
View Details