Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease 4 (RNASE4)

Product Specifications

Product Name Alternative

RNS4

Abbreviation

Recombinant Human RNASE4 protein

Gene Name

RNASE4

UniProt

P34096

Expression Region

29-147aa

Organism

Homo sapiens (Human)

Target Sequence

QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

This RNase has marked specificity towards the 3' side of uridine nucleotides.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This RNase has marked specificity towards the 3' side of uridine nucleotides.

Molecular Weight

20.8 kDa

References & Citations

"Human ribonuclease 4 (RNase 4) : coding sequence, chromosomal localization and identification of two distinct transcripts in human somatic tissues." Rosenberg H.F., Dyer K.D. Nucleic Acids Res. 23:4290-4295 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tumor protein D52 like 3 (TPD52L3) activation kit by CRISPRa
GA113951 1 Kit

Human Tumor protein D52 like 3 (TPD52L3) activation kit by CRISPRa

Sign In for Pricing
View Details
PABPC1L2A (PABPC1L2B) Human Gene Knockout Kit (CRISPR)
KN424446 1 Kit

PABPC1L2A (PABPC1L2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prnp Mouse Gene Knockout Kit (CRISPR)
KN313942 1 Kit

Prnp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha 1 Acid Glycoprotein Mouse Monoclonal Antibody [A4-G2-A3]
EM1510-42 100 µL

Alpha 1 Acid Glycoprotein Mouse Monoclonal Antibody [A4-G2-A3]

Sign In for Pricing
View Details
2-Nitroisophthalic Acid
TRC-N515275-1G 1 g

2-Nitroisophthalic Acid

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]
TA500069AM 100 µL

alpha 1 Antitrypsin (SERPINA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]

Sign In for Pricing
View Details