Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Abrus precatorius Abrin-a, partial

Product Specifications

Product Name Alternative

RRNA N-glycosidase

Abbreviation

Recombinant Abrus precatorius Abrin-a protein, partial

UniProt

P11140

Expression Region

1-251aa

Organism

Abrus precatorius (Indian licorice) (Glycine abrus)

Target Sequence

QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin. The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; FUNCTION

Molecular Weight

33.6 kDa

References & Citations

"The complete amino acid sequence of the A-chain of abrin-a, a toxic protein from the seeds of Abrus precatorius." Funatsu G., Taguchi Y., Kamenosono M., Yanaka M. Agric. Biol. Chem. 52:1095-1097 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Transporter, 4E-T, eIF4E Transporter, Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1, 2610509L04Rik, FLJ21601, FLJ26551) (APC)
126245-APC 100 µL

EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Transporter, 4E-T, eIF4E Transporter, Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1, 2610509L04Rik, FLJ21601, FLJ26551) (APC)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Alginate lyase (alyA)
MBS1458284-01 0.02 mg (E-Coli)

Recombinant Klebsiella pneumoniae Alginate lyase (alyA)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Alginate lyase (alyA)
MBS1458284-02 0.02 mg (Yeast)

Recombinant Klebsiella pneumoniae Alginate lyase (alyA)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Alginate lyase (alyA)
MBS1458284-03 0.1 mg (E-Coli)

Recombinant Klebsiella pneumoniae Alginate lyase (alyA)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Alginate lyase (alyA)
MBS1458284-04 0.1 mg (Yeast)

Recombinant Klebsiella pneumoniae Alginate lyase (alyA)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Alginate lyase (alyA)
MBS1458284-05 0.02 mg (Baculovirus)

Recombinant Klebsiella pneumoniae Alginate lyase (alyA)

Sign In for Pricing
View Details