Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A10 (S100A10)

Product Specifications

Product Name Alternative

Calpactin I light chain Calpactin-1 light chain Cellular ligand of annexin II S100 calcium-binding protein A10 p10 protein p11 ANX2LG, CAL1L, CLP11

Abbreviation

Recombinant Human S100A10 protein

Gene Name

S100A10

UniProt

P60903

Expression Region

1-97aa

Organism

Homo sapiens (Human)

Target Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.

Molecular Weight

18.2 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP11 Rabbit pAb, PE-Cy7 conjugated
orb2864867 100 µL

PARP11 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
SLC38A2 antibody
FNab10984 100 µg

SLC38A2 antibody

Sign In for Pricing
View Details
AFP Antibody
A43890-100UG 100 µg

AFP Antibody

Sign In for Pricing
View Details
LECT1 Polyclonal Antibody
E44H10025 100 µL

LECT1 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD1 Polyclonal Antibody
MBS2565641-01 0.06 mL

PSMD1 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD1 Polyclonal Antibody
MBS2565641-02 0.12 mL

PSMD1 Polyclonal Antibody

Sign In for Pricing
View Details