Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Enteropeptidase (TMPRSS15), partial

Product Specifications

Product Name Alternative

Enterokinase Serine protease 7 Transmembrane protease serine 15 ENTK, PRSS7

Abbreviation

Recombinant Bovine TMPRSS15 protein, partial

Gene Name

TMPRSS15

UniProt

P98072

Expression Region

801-1035aa

Organism

Bos taurus (Bovine)

Target Sequence

IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A) . It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A) . It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.

Molecular Weight

28.3 kDa

References & Citations

"Enterokinase, the initiator of intestinal digestion, is a mosaic protease composed of a distinctive assortment of domains." Kitamoto Y., Yuan X., Wu Q., McCourt D.W., Sadler J.E. Proc. Natl. Acad. Sci. U.S.A. 91:7588-7592 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79a (JCB117 + HM47/A9), Biotin conjugate, 0.1mg/mL
BNCB0828-500 1x 500 µL

CD79a (JCB117 + HM47/A9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3048-03S 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
Maleic Anhydride
TRC-M124400-10G 10 g

Maleic Anhydride

Sign In for Pricing
View Details
Setiptiline-d3
TRC-S280802-1MG 1 mg

Setiptiline-d3

Sign In for Pricing
View Details
Human TSLP Recombinant Rabbit monoclonal Antibody
HA723489B 100 µL

Human TSLP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MRPL13 (NM_014078) Human Recombinant Protein
TP306334L 1 mg

MRPL13 (NM_014078) Human Recombinant Protein

Sign In for Pricing
View Details