Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB)

Product Specifications

Product Name Alternative

Class 3 protein Porin

Abbreviation

Recombinant Neisseria meningitidis serogroup B porB protein

Gene Name

PorB

UniProt

P30688

Expression Region

20-331aa

Organism

Neisseria meningitidis serogroup B

Target Sequence

DVTLYGTIKAGVETSRSVEHNGGQVVSVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGKYNSESYHAGFNYKNGGFFVQYGGAYKRHVRVDENVNIEKYQIHRLVSGYDNDALHASVAVQQQDAKLVEDNYSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGSFDDADLSNDYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVSTAGGVGLRHKF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Serves as a slightly cation selective porin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Serves as a slightly cation selective porin.

Molecular Weight

37.8 kDa

References & Citations

"Sequence analysis and relationships between meningococcal class 3 serotype proteins and other porins from pathogenic and non-pathogenic Neisseria species." Ward M.J., Lambden P.R., Heckels J.E. FEMS Microbiol. Lett. 73:283-289 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP-1 Complex Subunit Mu-1 (AP1M1) Antibody
abx230459 100 µg

AP-1 Complex Subunit Mu-1 (AP1M1) Antibody

Sign In for Pricing
View Details
Mouse IgA Isotype Control Antibody (S107), PerCP
FMD76414 100 Tests

Mouse IgA Isotype Control Antibody (S107), PerCP

Sign In for Pricing
View Details
Lentiviral human TMEM199 sgRNA gene knockout kit - Lentiviral human TMEM199 sgRNA gene knockout kit (100)
GTR15395419 1 Vial

Lentiviral human TMEM199 sgRNA gene knockout kit - Lentiviral human TMEM199 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
MNAT1 (NM_002431) Human Tagged Lenti ORF Clone
RC201595L3 10 µg

MNAT1 (NM_002431) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
2-Ethylbutyric Acid
C11575 25 µL

2-Ethylbutyric Acid

Sign In for Pricing
View Details
TNIP3 Antibody
MBS8518094-01 0.05 mg

TNIP3 Antibody

Sign In for Pricing
View Details