Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans pH-regulated antigen PRA1 (PRA1)

Product Specifications

Product Name Alternative

58 kDa fibrinogen-binding mannoprotein FBP1

Abbreviation

Recombinant Candida albicans PRA1 protein

Gene Name

PRA1

UniProt

P87020

Expression Region

16-299aa

Organism

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Target Sequence

APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASSSHQHTDSNPSATTDANSHCHTHADGEVHC

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Cell surface protein involved in the host-parasite interaction during candidal infection. With MP65, represents a major component of the biofilm matrix. Sequesters zinc from host tissue and mediates leukocyte adhesion and migration. As a surface protein, binds the two human complement regulators CFH and CFHR1, as well as plasminogen PLG, mediates complement evasion and extra-cellular matrix interaction and/or degradation. As a released protein, enhances complement control in direct vicinity of the yeast and thus generates an additional protective layer which controls host complement attack, assisting the fungus in escaping host surveillance. Binds to host fluid-phase C3 and blocks cleavage of C3 to C3a and C3b, leading to inhibition of complement activation. Mediates also human complement control and complement evasion through binding to C4BPA, another human complement inhibitor, as well as through binding to host integrin alpha-M/beta-2. Decreases complement-mediated adhesion, as well as uptake of C.albicans by human macrophages.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cell surface protein involved in the host-parasite interaction during candidal infection. With MP65, represents a major component of the biofilm matrix. Sequesters zinc from host tissue and mediates leukocyte adhesion and migration. As a surface protein, binds the two human complement regulators CFH and CFHR1, as well as plasminogen PLG, mediates complement evasion and extra-cellular matrix interaction and/or degradation. As a released protein, enhances complement control in direct vicinity of the yeast and thus generates an additional protective layer which controls host complement attack, assisting the fungus in escaping host surveillance. Binds to host fluid-phase C3 and blocks cleavage of C3 to C3a and C3b, leading to inhibition of complement activation. Mediates also human complement control and complement evasion through binding to C4BPA, another human complement inhibitor, as well as through binding to host integrin alpha-M/beta-2. Decreases complement-mediated adhesion, as well as uptake of C.albicans by human macrophages.

Molecular Weight

33.4 kDa

References & Citations

"Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes." van het Hoog M., Rast T.J., Martchenko M., Grindle S., Dignard D., Hogues H., Cuomo C., Berriman M., Scherer S., Magee B.B., Whiteway M., Chibana H., Nantel A., Magee P.T. Genome Biol. 8:RESEARCH52.1-RESEARCH52.12 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2'-[Butane-1,4-diylbis(piperazine-1,4-diyl)]dipyrimidine
TRC-B689970-50MG 50 mg

2,2'-[Butane-1,4-diylbis(piperazine-1,4-diyl)]dipyrimidine

Sign In for Pricing
View Details
5-Chloroacenaphthenone
TRC-C367065-50MG 50 mg

5-Chloroacenaphthenone

Sign In for Pricing
View Details
cis-4-[[2-(1H-Benzimidazol-6-ylamino)-8-quinazolinyl]oxy]-cyclohexanol
TRC-B197005-5MG 5 mg

cis-4-[[2-(1H-Benzimidazol-6-ylamino)-8-quinazolinyl]oxy]-cyclohexanol

Sign In for Pricing
View Details
RET Mouse Monoclonal Antibody [Clone ID: OTI5D4]
CF805745 100 µg

RET Mouse Monoclonal Antibody [Clone ID: OTI5D4]

Sign In for Pricing
View Details
Uridine-13C,15N2 2',3',5'-Tribenzoate
TRC-U830047-2.5MG 2.5 mg

Uridine-13C,15N2 2',3',5'-Tribenzoate

Sign In for Pricing
View Details
Halogen Moisture analyzer BANA-504
BANA-504 1 Unit

Halogen Moisture analyzer BANA-504

Sign In for Pricing
View Details