Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 132A (TMEM132A), partial

Product Specifications

Product Name Alternative

HSPA5-binding protein 1 HSPA5BP1, KIAA1583

Abbreviation

Recombinant Human TMEM132A protein, partial

Gene Name

TMEM132A

UniProt

Q24JP5

Expression Region

642-742aa

Organism

Homo sapiens (Human)

Target Sequence

QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation (By similarity) .

Molecular Weight

17.4 kDa

References & Citations

"Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. DNA Res. 7:273-281 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Xanthoanthrafil (>90%)
TRC-X500000-10MG 10 mg

rac Xanthoanthrafil (>90%)

Sign In for Pricing
View Details
Human MCAF2 (ATF7IP2) activation kit by CRISPRa
GA112809 1 Kit

Human MCAF2 (ATF7IP2) activation kit by CRISPRa

Sign In for Pricing
View Details
Btbd11 Mouse Gene Knockout Kit (CRISPR)
KN502294 1 Kit

Btbd11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GSTp1 Polyclonal Antibody
D-AB-10131L-01 25 µL

GSTp1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTp1 Polyclonal Antibody
D-AB-10131L-02 100 µL

GSTp1 Polyclonal Antibody

Sign In for Pricing
View Details
L-Glutamic Acid-L-Arginine-L-Arginine-L-Isoleucine-L-Tryptophan-L-Phenylalanine-L-Proline-L-Tyrosine-L-Arginine-L-Arginine-L-Phenylalanine TFA Salt Hydrate
TRC-G001540-25MG 25 mg

L-Glutamic Acid-L-Arginine-L-Arginine-L-Isoleucine-L-Tryptophan-L-Phenylalanine-L-Proline-L-Tyrosine-L-Arginine-L-Arginine-L-Phenylalanine TFA Salt Hydrate

Sign In for Pricing
View Details