Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD63 antigen (CD63), partial

Product Specifications

Product Name Alternative

Granulophysin Lysosomal-associated membrane protein 3 Short name: LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name: Tspan-30 CD_antigen: CD63 MLA1, TSPAN30

Abbreviation

Recombinant Human CD63 protein, partial

Gene Name

CD63

UniProt

P08962

Expression Region

103-203aa

Organism

Homo sapiens (Human)

Target Sequence

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.

Molecular Weight

13.5 kDa

References & Citations

"CD63 antigen. A novel lysosomal membrane glycoprotein, cloned by a screening procedure for intracellular antigens in eukaryotic cells." Metzelaar M.J., Wigngaard P.L., Peters P.J., Sixma J.J., Nieuwenhuis H.K., Clevers H.C. J. Biol. Chem. 266:3239-3245 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASIC1 Antibody
MBS7122869-01 0.05 mg

ASIC1 Antibody

Sign In for Pricing
View Details
ASIC1 Antibody
MBS7122869-02 0.1 mg

ASIC1 Antibody

Sign In for Pricing
View Details
ASIC1 Antibody
MBS7122869-03 5x 0.1 mg

ASIC1 Antibody

Sign In for Pricing
View Details
DCAF5 Protein Vector (Human) (pPB-C-His)
PV072301 500 ng

DCAF5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ML390
HY-100688-01 5 mg

ML390

Sign In for Pricing
View Details
ML390
HY-100688-02 10 mM - 1 mL

ML390

Sign In for Pricing
View Details