Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LACTB2, Human (GST)

As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

LACTB2 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lactb2-protein-human-gst.html

Smiles

MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL

Molecular Formula

51110 (Gene_ID) Q53H82 (M1-L288) (Accession)

Molecular Weight

Approximately 56 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF740 conjugate, 0.1mg/mL
BNC743811-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARHGAP25 Rabbit Polyclonal Antibody
TA368921 100 µL

ARHGAP25 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin-11-dUTP *1 mM in TE Buffer (pH 7.5) * *CAS 86303-25-5*
17016-AAT 25 nmoles

Biotin-11-dUTP *1 mM in TE Buffer (pH 7.5) * *CAS 86303-25-5*

Sign In for Pricing
View Details
1810063B07Rik (BC027644) Mouse Tagged ORF Clone
MG201771 10 µg

1810063B07Rik (BC027644) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF405S conjugate, 0.1mg/mL
BNC042868-500 1x 500 µL

Serum Amyloid A (SAA/2868R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant GLI1 Antibody
RC-15269-01 50 μL

Recombinant GLI1 Antibody

Sign In for Pricing
View Details