Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LACTB2, Human (GST)

As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

LACTB2 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lactb2-protein-human-gst.html

Smiles

MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL

Molecular Formula

51110 (Gene_ID) Q53H82 (M1-L288) (Accession)

Molecular Weight

Approximately 56 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ate1 activation kit by CRISPRa
GA200303 1 Kit

Mouse Ate1 activation kit by CRISPRa

Sign In for Pricing
View Details
1-Phenyl-2-pentanone
TRC-P335855-1G 1 g

1-Phenyl-2-pentanone

Sign In for Pricing
View Details
Human PATE (PATE1) activation kit by CRISPRa
GA115994 1 Kit

Human PATE (PATE1) activation kit by CRISPRa

Sign In for Pricing
View Details
Human TRIAD3 (RNF216) activation kit by CRISPRa
GA110126 1 Kit

Human TRIAD3 (RNF216) activation kit by CRISPRa

Sign In for Pricing
View Details
CD1C Human Gene Knockout Kit (CRISPR)
KN418490 1 Kit

CD1C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Larotrectinib Sulfate
TRC-L175933-250MG 250 mg

Larotrectinib Sulfate

Sign In for Pricing
View Details