Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease inhibitor A3N (Serpina3n)

Product Specifications

Product Name Alternative

Spi2

Abbreviation

Recombinant Mouse Serpina3n protein

Gene Name

Serpina3n

UniProt

Q91WP6

Expression Region

21-418aa

Organism

Mus musculus (Mouse)

Target Sequence

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

The single human alpha1-antichymotrypsin gene (SERPINA3) is represented by a cluster of 14 individual murine paralogs.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.8 kDa

References & Citations

"A review and comparison of the murine alpha1-antitrypsin and alpha1-antichymotrypsin multigene clusters with the human clade A serpins." Forsyth S., Horvath A., Coughlin P. Genomics 81:336-345 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas fluorescens Membrane protein insertase YidC (yidC)
MBS7034783-01 0.02 mg

Recombinant Pseudomonas fluorescens Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Membrane protein insertase YidC (yidC)
MBS7034783-02 0.1 mg

Recombinant Pseudomonas fluorescens Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens Membrane protein insertase YidC (yidC)
MBS7034783-03 5x 0.1 mg

Recombinant Pseudomonas fluorescens Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Mouse Monoclonal Vimentin Antibody (979542) [Alexa Fluor 405]
MAB21053AF405 0.1 mL

Mouse Monoclonal Vimentin Antibody (979542) [Alexa Fluor 405]

Sign In for Pricing
View Details
MIR6317 Rat MicroRNA Expression Plasmid (MI0021839)
SC403457 10 µg

MIR6317 Rat MicroRNA Expression Plasmid (MI0021839)

Sign In for Pricing
View Details
MT-ND6 Polyclonal Antibody
MBS8578740-01 0.1 mL

MT-ND6 Polyclonal Antibody

Sign In for Pricing
View Details