Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease inhibitor A3N (Serpina3n)

Product Specifications

Product Name Alternative

Spi2

Abbreviation

Recombinant Mouse Serpina3n protein

Gene Name

Serpina3n

UniProt

Q91WP6

Expression Region

21-418aa

Organism

Mus musculus (Mouse)

Target Sequence

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

The single human alpha1-antichymotrypsin gene (SERPINA3) is represented by a cluster of 14 individual murine paralogs.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.8 kDa

References & Citations

"A review and comparison of the murine alpha1-antitrypsin and alpha1-antichymotrypsin multigene clusters with the human clade A serpins." Forsyth S., Horvath A., Coughlin P. Genomics 81:336-345 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALOX15B, CT (ALOX15B, Arachidonate 15-lipoxygenase B, 15-lipoxygenase 2, Arachidonate 15-lipoxygenase type II) (HRP) discontinued
031813-HRP 200 µL

ALOX15B, CT (ALOX15B, Arachidonate 15-lipoxygenase B, 15-lipoxygenase 2, Arachidonate 15-lipoxygenase type II) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Tgfbr1 Antibody (Center)
MBS9207501-01 0.08 mL

Mouse Tgfbr1 Antibody (Center)

Sign In for Pricing
View Details
Mouse Tgfbr1 Antibody (Center)
MBS9207501-02 0.4 mL

Mouse Tgfbr1 Antibody (Center)

Sign In for Pricing
View Details
Mouse Tgfbr1 Antibody (Center)
MBS9207501-03 5x 0.4 mL

Mouse Tgfbr1 Antibody (Center)

Sign In for Pricing
View Details
Human Cluster Of Differentiation 52 (CD52) ELISA Kit
MBS2703112-01 24 Strip Well

Human Cluster Of Differentiation 52 (CD52) ELISA Kit

Sign In for Pricing
View Details
Human Cluster Of Differentiation 52 (CD52) ELISA Kit
MBS2703112-02 48 Well

Human Cluster Of Differentiation 52 (CD52) ELISA Kit

Sign In for Pricing
View Details